WASF2 Antibody


Western Blot: WASF2 Antibody [NBP1-74224] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

WASF2 Antibody Summary

Synthetic peptides corresponding to the N terminal of Wasf2. Immunizing peptide sequence ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Wasf2 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WASF2 Antibody

  • IMD2
  • Protein WAVE-2
  • SCAR2suppressor of cyclic-AMP receptor (WASP-family)
  • Verprolin homology domain-containing protein 2
  • WAS protein family, member 2
  • WASP family Verprolin-homologous protein 2
  • WAVE2dJ393P12.2
  • wiskWASP family protein member 2


Wasf2 is a downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. It promotes formation of actin filaments. Wasf2 is a part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for WASF2 Antibody (NBP1-74224) (0)

There are no publications for WASF2 Antibody (NBP1-74224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASF2 Antibody (NBP1-74224) (0)

There are no reviews for WASF2 Antibody (NBP1-74224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WASF2 Antibody (NBP1-74224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WASF2 Products

Bioinformatics Tool for WASF2 Antibody (NBP1-74224)

Discover related pathways, diseases and genes to WASF2 Antibody (NBP1-74224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WASF2 Antibody (NBP1-74224)

Discover more about diseases related to WASF2 Antibody (NBP1-74224).

Pathways for WASF2 Antibody (NBP1-74224)

View related products by pathway.

PTMs for WASF2 Antibody (NBP1-74224)

Learn more about PTMs related to WASF2 Antibody (NBP1-74224).

Blogs on WASF2

There are no specific blogs for WASF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WASF2 Antibody and receive a gift card or discount.


Gene Symbol WASF2