Recombinant Human WARS2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WARS2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32874 of Human WARS2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
WARS2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WARS2 Protein

  • (Mt)TrpRS
  • EC 6.1.1
  • EC 6.1.1.2
  • TrpRStryptophan-tRNA ligase
  • tryptophan tRNA ligase 2, mitochondrial
  • Tryptophan--tRNA ligase
  • tryptophanyl tRNA synthetase 2, mitochondrial
  • tryptophanyl-tRNA synthetase, mitochondrial

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010352-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for WARS2 Partial Recombinant Protein (H00010352-Q02) (0)

There are no publications for WARS2 Partial Recombinant Protein (H00010352-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WARS2 Partial Recombinant Protein (H00010352-Q02) (0)

There are no reviews for WARS2 Partial Recombinant Protein (H00010352-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WARS2 Partial Recombinant Protein (H00010352-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WARS2 Products

Bioinformatics Tool for WARS2 Partial Recombinant Protein (H00010352-Q02)

Discover related pathways, diseases and genes to WARS2 Partial Recombinant Protein (H00010352-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WARS2

There are no specific blogs for WARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WARS2 Antibody
NBP1-54653

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WARS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WARS2