Recombinant Human WARS2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human WARS2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 113-222 of Human WARS2

Source: Wheat Germ

Amino Acid Sequence: QQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
WARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WARS2 Protein

  • (Mt)TrpRS
  • EC 6.1.1
  • EC 6.1.1.2
  • TrpRStryptophan-tRNA ligase
  • tryptophan tRNA ligase 2, mitochondrial
  • Tryptophan--tRNA ligase
  • tryptophanyl tRNA synthetase 2, mitochondrial
  • tryptophanyl-tRNA synthetase, mitochondrial

Background

WARS2 - tryptophanyl tRNA synthetase 2 (mitochondrial)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010352-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for WARS2 Partial Recombinant Protein (H00010352-Q01) (0)

There are no publications for WARS2 Partial Recombinant Protein (H00010352-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WARS2 Partial Recombinant Protein (H00010352-Q01) (0)

There are no reviews for WARS2 Partial Recombinant Protein (H00010352-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WARS2 Partial Recombinant Protein (H00010352-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WARS2 Products

Bioinformatics Tool for WARS2 Partial Recombinant Protein (H00010352-Q01)

Discover related pathways, diseases and genes to WARS2 Partial Recombinant Protein (H00010352-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WARS2

There are no specific blogs for WARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WARS2 Antibody
NBP2-57679

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WARS2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WARS2