WARS2 Antibody (3D8)

Product Discontinued

WARS2 Antibody (3D8) Summary

• Immunogen: WARS2 (NP_056651.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQ
• Specificity: WARS2 - tryptophanyl tRNA synthetase 2, mitochondrial (3D8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WARS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WARS2 Antibody (3D8)

• (Mt)TrpRS
• EC 6.1.1
• EC 6.1.1.2
• TrpRStryptophan-tRNA ligase
• tryptophan tRNA ligase 2, mitochondrial
• Tryptophan--tRNA ligase
• tryptophanyl tRNA synthetase 2, mitochondrial
• tryptophanyl-tRNA synthetase, mitochondrial

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WARS2
• Entrez:
  • 10352(Human)
• Uniprot:
  • NP_056651(Human)