WAC Recombinant Protein Antigen

Images

 
There are currently no images for WAC Protein (NBP1-88581PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WAC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WAC.

Source: E.coli

Amino Acid Sequence: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WAC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88581.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for WAC Recombinant Protein Antigen

  • 1110067P07Rik
  • bA48B24
  • bA48B24.1
  • BM-016
  • FLJ31290
  • KIAA1844
  • MGC10753
  • PRO1741
  • WW domain containing adaptor with coiled-coil
  • WW domain-containing adapter protein with coiled-coil
  • WW domain-containing adaptor with coiled coil
  • Wwp4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB600-279
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-72058
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP2-65538
Species: Hu
NBP1-88581PEP
Species: Hu
Applications: AC

Publications for WAC Protein (NBP1-88581PEP) (0)

There are no publications for WAC Protein (NBP1-88581PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WAC Protein (NBP1-88581PEP) (0)

There are no reviews for WAC Protein (NBP1-88581PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for WAC Protein (NBP1-88581PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-88581PEP

Bioinformatics Tool for WAC Protein (NBP1-88581PEP)

Discover related pathways, diseases and genes to WAC Protein (NBP1-88581PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WAC Protein (NBP1-88581PEP)

Discover more about diseases related to WAC Protein (NBP1-88581PEP).
 

Pathways for WAC Protein (NBP1-88581PEP)

View related products by pathway.

PTMs for WAC Protein (NBP1-88581PEP)

Learn more about PTMs related to WAC Protein (NBP1-88581PEP).

Blogs on WAC

There are no specific blogs for WAC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WAC Antibody
NBP1-88581
CRIPTO Antibody
NB100-1598

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WAC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WAC