VRK1 Antibody

Western Blot: VRK1 Antibody [NBP1-89548] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-VRK1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: VRK1 Antibody [NBP1-89548] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.

Immunohistochemistry-Paraffin: VRK1 Antibody [NBP1-89548] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells.

Western Blot: VRK1 Antibody [NBP1-89548] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-629

Immunohistochemistry-Paraffin: VRK1 Antibody [NBP1-89548] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Immunohistochemistry-Paraffin: VRK1 Antibody [NBP1-89548] - Analysis in human testis and skeletal muscle tissues. Corresponding VRK1 RNA-seq data are presented for the same tissues.

Immunohistochemistry: VRK1 Antibody [NBP1-89548] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: VRK1 Antibody [NBP1-89548] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: VRK1 Antibody [NBP1-89548] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Discontinued

VRK1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VRK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VRK1 Antibody

• EC 2.7.11.1
• MGC117401
• MGC138280
• MGC142070
• PCH1
• serine/threonine-protein kinase VRK1
• vaccinia related kinase 1
• vaccinia virus B1R-related kinase 1
• Vaccinia-related kinase 1
• VRK1

Background

VRK1 encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VRK1 Antibody (NBP1-89548)(1)

Publication using NBP1-89548

• Sikorski K, Mehta A et al. A high-throughput pipeline for validation of antibodies. Nat Methods 2018-01-11 [PMID: 30377371] (Human)
  
  Details:
  Antibody validation based on denaturing gel electrophoresis of biotinylated cell lysates (PAGE) followed by mass spectrometry (MS) and antibody array analysis (MAP).

Bioinformatics

• Gene Symbol: VRK1