VPS41 Antibody - BSA Free

Western Blot: VPS41 Antibody [NBP2-88582] - Host: Rabbit. Target Name: VPS41. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VPS41 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human VPS41. Peptide sequence: DAASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDES The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS41
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VPS41 Antibody - BSA Free

• HVPS41
• hVps41p
• HVSP41
• S53
• vacuolar assembly protein 41
• vacuolar protein sorting 41 (yeast homolog)
• vacuolar protein sorting 41 (yeast)
• vacuolar protein sorting 41 homolog (S. cerevisiae)
• vacuolar protein sorting-associated protein 41 homolog

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS41