VPS28 Recombinant Protein Antigen

Images

 
There are currently no images for VPS28 Protein (NBP1-85973PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VPS28 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS28.

Source: E. coli

Amino Acid Sequence: VQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85973. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VPS28 Recombinant Protein Antigen

  • ESCRT-I complex subunit VPS28
  • H-Vps28
  • MGC60323
  • vacuolar protein sorting 28 (yeast)
  • vacuolar protein sorting 28 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 28 homolog
  • yeast class E protein Vps28p homolog

Background

VPS28 encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) involved in the sorting of ubiquitinated proteins. The two other subunits of ESCRT-I are vesicular protein sorting 23, also known as tumor susceptibility gene 101 (TSG101), and vesicular protein sorting 37. Two alternative transcripts encoding different isoforms have been described. Additional alternative transcripts may exist but the proteins encoded by these transcripts have not been verified experimentally.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-112
Species: Ca, Ha, Hu, Pm, Mu, Po, Rt, Ze
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, KD, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-83202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP2-20881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80651
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82283
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vivo
NBP1-83528
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91882
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15125
Species: Hu, Ze
Applications: IHC-WhMt, IHC,  IHC-P, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13519
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2438
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB6015
Species: Hu, Mu, Rt
Applications: WB

Publications for VPS28 Protein (NBP1-85973PEP) (0)

There are no publications for VPS28 Protein (NBP1-85973PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS28 Protein (NBP1-85973PEP) (0)

There are no reviews for VPS28 Protein (NBP1-85973PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS28 Protein (NBP1-85973PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS28 Products

Research Areas for VPS28 Protein (NBP1-85973PEP)

Find related products by research area.

Blogs on VPS28

There are no specific blogs for VPS28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS28 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS28