VPS16 Recombinant Protein Antigen

Images

 
There are currently no images for VPS16 Recombinant Protein Antigen (NBP2-48912PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VPS16 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS16.

Source: E. coli

Amino Acid Sequence: LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48912.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VPS16 Recombinant Protein Antigen

  • hVPS16
  • vacuolar protein sorting 16 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 16
  • vacuolar protein sorting-associated protein 16 homolog

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinctorganelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved invesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian classC Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, maymediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding differentisoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82906
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-47583
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2425
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF2910
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-76535
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00338382-M01
Species: Hu
Applications: ELISA, IP, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-45582
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-98931
Species: Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP3-45589
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for VPS16 Recombinant Protein Antigen (NBP2-48912PEP) (0)

There are no publications for VPS16 Recombinant Protein Antigen (NBP2-48912PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS16 Recombinant Protein Antigen (NBP2-48912PEP) (0)

There are no reviews for VPS16 Recombinant Protein Antigen (NBP2-48912PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS16 Recombinant Protein Antigen (NBP2-48912PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS16 Products

Array NBP2-48912PEP

Blogs on VPS16.

UVRAG - A regulator of membrane trafficking in autophagy and endocytosis
UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS16 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS16