VPREB3 Antibody - Azide and BSA Free

Western Blot: VPREB3 Antibody [H00029802-B01P] - Analysis of VPREB3 expression in transfected 293T cell line by VPREB3 polyclonal antibody. Lane 1: VPREB3 transfected lysate(13.53 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: VPREB3 Antibody [H00029802-B01P] - Analysis of purified antibody to VPREB3 on formalin-fixed paraffin-embedded human tonsil. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

VPREB3 Antibody - Azide and BSA Free Summary

• Immunogen: VPREB3 (NP_037510.1, 1 a.a. - 123 a.a.) full-length human protein. MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
• Specificity: Reacts with pre-B lymphocyte 3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: VPREB3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: This antibody is reactive against transfected lysate in western blot, immunohistochemistry (paraffin sections), and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VPREB3 Antibody - Azide and BSA Free

• N27C7-2
• pre-B lymphocyte 3,8HS20
• pre-B lymphocyte gene 3
• pre-B lymphocyte protein 3
• Protein VPreB3

Background

The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPREB3
• Entrez:
  • 29802(Human)
• Uniprot:
  • NP_037510.1(Human)