VNN3 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse VNN3 Antibody - Azide and BSA Free (H00055350-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
VNN3 (NP_523239.1, 1 a.a. - 147 a.a.) full-length human protein. MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRKSKKMNEPVSKELCYHCHSECNQYGQWKLYRT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
VNN3P |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for VNN3 Antibody - Azide and BSA Free
Background
VNN3 is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: WB
Publications for VNN3 Antibody (H00055350-B01P) (0)
There are no publications for VNN3 Antibody (H00055350-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VNN3 Antibody (H00055350-B01P) (0)
There are no reviews for VNN3 Antibody (H00055350-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VNN3 Antibody (H00055350-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VNN3 Products
Blogs on VNN3