VMAT1/SLC18A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-58895] - Analysis in human adrenal gland and pancreas tissues using NBP2-58895 antibody. Corresponding VMAT1/SLC18A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-58895] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-58895] -Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-58895] -Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-58895] -Staining of human pancreas shows no expression in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VMAT1/SLC18A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC18A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VMAT1/SLC18A1 Antibody - BSA Free

• CGAT
• SLC18A1
• solute carrier family 18 (vesicular monoamine), member 1
• VAT1
• VMAT1

Background

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VMAT1/SLC18A1 Antibody (NBP2-58895)(1)

Publication using NBP2-58895

• Wu HF, Art J, Saini T et Al. Protocol for generating postganglionic sympathetic neurons using human pluripotent stem cells for electrophysiological and functional assessments STAR Protoc 2024-03-21 [PMID: 38517897]

Bioinformatics

• Gene Symbol: SLC18A1