Vitronectin Recombinant Protein Antigen

Images

 
There are currently no images for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Vitronectin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vitronectin.

Source: E. coli

Amino Acid Sequence: KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38901.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vitronectin Recombinant Protein Antigen

  • Complement S-protein
  • epibolin
  • Serum Spreading Factor
  • Serum-spreading factor
  • Somatomedin B
  • S-protein
  • V75
  • vitronectin (serum spreading factor, somatomedin B, complement S-protein)
  • Vitronectin
  • VN
  • VNT
  • VTN

Background

Vitronectin also called serum spreading factor or complement S-protein, is a member of the pexin family (1). Found in serum and in tissues, Vitronectin exist in two forms; as a single chain (75kDa) and as a clipped form composed of two chains (65kDa and 10kDa). Vitronectin promotes cell adhesion, spreading and migration through specific interactions with cellular integrins, and inhibits cytolysis by the complement C5b-9 complex (2-4). Vitronectin also interacts with several critical proteins that regulate thrombosis and fibrinolysis. Vitronectin is phosphorylated by PKA and CKII (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
1310-SE
Species: Hu
Applications: EnzAct
DUP00
Species: Hu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
MAB2528
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-80633
Species: Hu
Applications: IHC,  IHC-P
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DTPA00
Species: Hu
Applications: ELISA
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no publications for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no reviews for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vitronectin Products

Research Areas for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP)

Find related products by research area.

Blogs on Vitronectin

There are no specific blogs for Vitronectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vitronectin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VTN