VISTA/B7-H5/PD-1H Antibody

Images

 
Western Blot: VISTA/B7-H5/PD-1H Antibody [NBP1-88967] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP1-88967] - Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in leukocytes.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP1-88967] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in leukocytes.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP1-88967] - Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VISTA/B7-H5/PD-1H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C10ORF54
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VISTA/B7-H5/PD-1H Protein (NBP1-88967PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VISTA/B7-H5/PD-1H Antibody

  • 4632428N05Rik
  • B7H5
  • B7-H5
  • C10orf54
  • chromosome 10 open reading frame 54
  • Dies1
  • Gi24
  • PD1H
  • PD-1H
  • platelet receptor Gi24
  • PP2135
  • SISP1
  • stress induced secreted protein 1
  • VISTA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4049
Species: Hu
Applications: WB, Simple Western
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VISTA/B7-H5/PD-1H Antibody (NBP1-88967) (0)

There are no publications for VISTA/B7-H5/PD-1H Antibody (NBP1-88967).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VISTA/B7-H5/PD-1H Antibody (NBP1-88967) (0)

There are no reviews for VISTA/B7-H5/PD-1H Antibody (NBP1-88967). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VISTA/B7-H5/PD-1H Antibody (NBP1-88967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VISTA/B7-H5/PD-1H Products

Bioinformatics Tool for VISTA/B7-H5/PD-1H Antibody (NBP1-88967)

Discover related pathways, diseases and genes to VISTA/B7-H5/PD-1H Antibody (NBP1-88967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VISTA/B7-H5/PD-1H

There are no specific blogs for VISTA/B7-H5/PD-1H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VISTA/B7-H5/PD-1H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C10ORF54
Entrez