VISTA/B7-H5/PD-1H Antibody (CL3981)


Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP2-59031] - Staining of human tonsil shows immunoreactivity in a subset of lymphoid and epithelial cells.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP2-59031] - Staining of human small intestine shows strong immunoreactivity in lymphoid cells.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP2-59031] - Staining of human cerebral cortex shows positivity in a subset of cells and blood vessels.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP2-59031] - Staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblast.
Immunohistochemistry-Paraffin: VISTA/B7-H5/PD-1H Antibody [NBP2-59031] - Staining of human liver shows strong positivity in a subset of lymphoid cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

VISTA/B7-H5/PD-1H Antibody (CL3981) Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Specificity of human VISTA/B7-H5/PD-1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2000
  • Immunohistochemistry-Paraffin 1:1000 - 1:2000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for VISTA/B7-H5/PD-1H Antibody (CL3981)

  • 4632428N05Rik
  • B7H5
  • B7-H5
  • C10orf54
  • chromosome 10 open reading frame 54
  • Dies1
  • Gi24
  • PD1H
  • PD-1H
  • platelet receptor Gi24
  • PP2135
  • SISP1
  • stress induced secreted protein 1
  • VSIR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Species: Hu
Applications: WB, Simple Western
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for VISTA/B7-H5/PD-1H Antibody (NBP2-59031) (0)

There are no publications for VISTA/B7-H5/PD-1H Antibody (NBP2-59031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VISTA/B7-H5/PD-1H Antibody (NBP2-59031) (0)

There are no reviews for VISTA/B7-H5/PD-1H Antibody (NBP2-59031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VISTA/B7-H5/PD-1H Antibody (NBP2-59031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for VISTA/B7-H5/PD-1H Antibody (NBP2-59031)

Discover related pathways, diseases and genes to VISTA/B7-H5/PD-1H Antibody (NBP2-59031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for VISTA/B7-H5/PD-1H Antibody (NBP2-59031)

Find related products by research area.

Blogs on VISTA/B7-H5/PD-1H

There are no specific blogs for VISTA/B7-H5/PD-1H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VISTA/B7-H5/PD-1H Antibody (CL3981) and receive a gift card or discount.


Gene Symbol C10ORF54