Viperin Antibody

Images

 
Western Blot: Viperin Antibody [NBP1-84467] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Viperin Antibody [NBP1-84467] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Viperin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Viperin Protein (NBP1-84467PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Viperin Antibody

  • 2510004L01Rik
  • cig33
  • cig5
  • Cytomegalovirus-induced gene 5 protein
  • interferon-inducible
  • radical S-adenosyl methionine domain containing 2
  • radical S-adenosyl methionine domain-containing protein 2
  • vig1
  • viperin
  • Virus inhibitory protein, endoplasmic reticulum-associated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-31237
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Viperin Antibody (NBP1-84467) (0)

There are no publications for Viperin Antibody (NBP1-84467).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Viperin Antibody (NBP1-84467) (0)

There are no reviews for Viperin Antibody (NBP1-84467). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Viperin Antibody (NBP1-84467) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Viperin Products

Bioinformatics Tool for Viperin Antibody (NBP1-84467)

Discover related pathways, diseases and genes to Viperin Antibody (NBP1-84467). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Viperin Antibody (NBP1-84467)

Discover more about diseases related to Viperin Antibody (NBP1-84467).
 

Pathways for Viperin Antibody (NBP1-84467)

View related products by pathway.

PTMs for Viperin Antibody (NBP1-84467)

Learn more about PTMs related to Viperin Antibody (NBP1-84467).

Blogs on Viperin.

Viperin: A Cellular Inhibitor of DNA and RNA Viruses
Viperin (Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) inhibits the replication of a broad spectrum of viruses by several diverse mechanisms. The protein was first identified in 2001, when it was found to be the pro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Viperin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSAD2
Entrez
Uniprot