Vinexin Antibody

Images

 
Western Blot: Vinexin Antibody [NBP1-87084] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Vinexin Antibody [NBP1-87084] - Staining of human skeletal muscle shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vinexin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GPASAWSSSYPHAPYLGSARSLSPHKMADGGSPFLGRRDFVYPSSTRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORBS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vinexin Protein (NBP1-87084PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vinexin Antibody

  • SCAM-1SH3-containing adapter molecule 1
  • SCAM1vinexin beta (SH3-containing adaptor molecule-1)
  • SH3D4VINEXIN
  • sorbin and SH3 domain containing 3
  • Sorbin and SH3 domain-containing protein 3
  • vinexin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88836
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-55619
Species: Hu
Applications: ICC/IF
NBP1-45223
Species: Hu, Mu, Ca
Applications: IHC-P, PEP-ELISA
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu

Publications for Vinexin Antibody (NBP1-87084) (0)

There are no publications for Vinexin Antibody (NBP1-87084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vinexin Antibody (NBP1-87084) (0)

There are no reviews for Vinexin Antibody (NBP1-87084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vinexin Antibody (NBP1-87084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vinexin Products

Bioinformatics Tool for Vinexin Antibody (NBP1-87084)

Discover related pathways, diseases and genes to Vinexin Antibody (NBP1-87084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vinexin Antibody (NBP1-87084)

Discover more about diseases related to Vinexin Antibody (NBP1-87084).
 

Pathways for Vinexin Antibody (NBP1-87084)

View related products by pathway.

Blogs on Vinexin

There are no specific blogs for Vinexin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vinexin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SORBS3