VDAC3 Antibody - BSA Free

Western Blot: VDAC3 Antibody [NBP2-82379] - Host: Rabbit. Target Name: VDAC3. Sample Tissue: Mouse Heart lysates. Antibody Dilution: 1ug/ml

Product Discontinued

VDAC3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse VDAC3. Peptide sequence: CNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VDAC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VDAC3 Antibody - BSA Free

• HD-VDAC3
• hVDAC3
• Outer mitochondrial membrane protein porin 3
• VDAC-3
• voltage-dependent anion channel 3
• voltage-dependent anion-selective channel protein 3

Background

The Voltage-Dependant Anion Channel (VDAC3) of the outer mitochondrial membrane, a small abundant protein found in all eukaryotic kingdoms, forms a voltage-gated pore when incorporated into planar lipid bilayers. VDAC is also the site of binding of the metabolic enzymes hexokinase and glycerol kinase to the mitochondrion in what may be a significant metabolic regulatory interaction. VDAC3 is involved specifically in translocation of adenine nucleotides through the outer membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VDAC3