VDAC1 Antibody (4C4)

Images

 
ELISA: VDAC1 Antibody (4C4) [H00007416-M05] - Detection limit for recombinant GST tagged VDAC1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VDAC1 Antibody (4C4) Summary

Immunogen
VDAC1 (AAH08482, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD
Marker
Mitochondria Marker
Specificity
VDAC1 - voltage-dependent anion channel 1 (4C4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VDAC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VDAC1 Antibody (4C4)

  • hVDAC1
  • MGC111064
  • Outer mitochondrial membrane protein porin 1
  • Plasmalemmal porin
  • Porin 31HL
  • Porin 31HM
  • PORIN
  • PORIN-31-HL
  • VDAC
  • VDAC-1
  • voltage-dependent anion channel 1
  • voltage-dependent anion-selective channel protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-80070
Species: Hu
Applications: WB, IHC
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00007416-M05
Species: Hu
Applications: WB, ELISA

Publications for VDAC1 Antibody (H00007416-M05) (0)

There are no publications for VDAC1 Antibody (H00007416-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC1 Antibody (H00007416-M05) (0)

There are no reviews for VDAC1 Antibody (H00007416-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC1 Antibody (H00007416-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VDAC1 Products

Bioinformatics Tool for VDAC1 Antibody (H00007416-M05)

Discover related pathways, diseases and genes to VDAC1 Antibody (H00007416-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC1 Antibody (H00007416-M05)

Discover more about diseases related to VDAC1 Antibody (H00007416-M05).
 

Pathways for VDAC1 Antibody (H00007416-M05)

View related products by pathway.

PTMs for VDAC1 Antibody (H00007416-M05)

Learn more about PTMs related to VDAC1 Antibody (H00007416-M05).

Blogs on VDAC1

There are no specific blogs for VDAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VDAC1 Antibody (4C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC1
Entrez
Uniprot