VAX1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
VAX1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for VAX1 Antibody
Background
VAX1 encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Ca, Hu, Pm
Applications: WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: Bind
Species: Hu
Applications: IHC, IP, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for VAX1 Antibody (NBP1-86372)(1)
Showing Publication 1 -
1 of 1.
Reviews for VAX1 Antibody (NBP1-86372) (0)
There are no reviews for VAX1 Antibody (NBP1-86372).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAX1 Antibody (NBP1-86372). (Showing 1 - 1 of 1 FAQ).
-
Does the antibody (VAX1 Antibody (NBP1-86372) ) work with mouse protein?
- This particular antibody has not yet been tested with mouse samples, which means use with mouse would not be covered by our guarantee. The exact immunogen sequence of NBP1-86372 is available, so I have run a sequence analysis (UniProt Blast) of this to obtain an indication of likely cross-reactivity. The result was a 93% match to the mouse protein (both isoforms 1 and 2), which is a high number that does indicate that the antibody will indeed cross-react with mouse. If you did want to test this antibody with mouse samples, note that you would be eligible for our special Innovator's Reward program, where in return for sharing your results with us (whether the antibody proved suitable or not) by completing a review, we would give you a voucher code for the price of the product. Please contact us at innovators@novusbio.com for more details.
Secondary Antibodies
| |
Isotype Controls
|
Additional VAX1 Products
Research Areas for VAX1 Antibody (NBP1-86372)
Find related products by research area.
|
Blogs on VAX1