VAT1 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2). GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
VAT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Knockout Validated
- Western Blot 1:500-1:2000
|
| Theoretical MW |
42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VAT1 Antibody - Azide and BSA Free
Background
VAT1 - vesicle amine transport protein 1 homolog (T californica)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: EM, ELISA, ICC/IF, Simple Western, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: IA, ICC/IF, IHC, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF (-), WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for VAT1 Antibody (NBP2-93463) (0)
There are no publications for VAT1 Antibody (NBP2-93463).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VAT1 Antibody (NBP2-93463) (0)
There are no reviews for VAT1 Antibody (NBP2-93463).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAT1 Antibody (NBP2-93463) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VAT1 Products
Research Areas for VAT1 Antibody (NBP2-93463)
Find related products by research area.
|
Blogs on VAT1