Vasorin/SLIT-like 2 Antibody (4G7) - Azide and BSA Free

Western Blot: Vasorin/SLIT-like 2 Antibody (4G7) [H00114990-M05] - Analysis of VASN expression in transfected 293T cell line by VASN monoclonal antibody (M05), clone 4G7. Lane 1: VASN transfected lysate (Predicted MW: 71.7 KDa). Lane 2: Non-transfected lysate.

ELISA: Vasorin/SLIT-like 2 Antibody (4G7) [H00114990-M05] - Detection limit for recombinant GST tagged SLITL2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Vasorin/SLIT-like 2 Antibody (4G7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Vasorin/SLIT-like 2 Antibody (4G7) - Azide and BSA Free (H00114990-M05) is a monoclonal antibody validated for use in WB and ELISA. Anti-Vasorin/SLIT-like 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
• Specificity: SLITL2 - slit-like 2 (Drosophila) (4G7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: VASN
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Vasorin/SLIT-like 2 Antibody (4G7) - Azide and BSA Free

• Atia
• Protein slit-like 2
• SLIT like 2
• Slitl2
• slit-like 2 (Drosophila)
• slit-like 2
• VASN
• Vasorin

Background

May act as an inhibitor of TGF-beta signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Vasorin/SLIT-like 2 Antibody (H00114990-M05)(1)

Publication using H00114990-M05

• Huang A, Dong J, Li S et al. Exosomal Transfer of Vasorin Expressed in Hepatocellular Carcinoma Cells Promotes Migration of Human Umbilical Vein Endothelial Cells. Int. J. Biol. Sci. 2015. 2015-01-01 [PMID: 26157350]

Bioinformatics

• Gene Symbol: VASN
• OMIM:
  • 608843(Human)