Vasorin/SLIT-like 2 Antibody (4G7)


Western Blot: Vasorin/SLIT-like 2 Antibody (4G7) [H00114990-M05] - Analysis of VASN expression in transfected 293T cell line by VASN monoclonal antibody (M05), clone 4G7. Lane 1: VASN transfected lysate (Predicted MW: more
ELISA: Vasorin/SLIT-like 2 Antibody (4G7) [H00114990-M05] - Detection limit for recombinant GST tagged SLITL2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

Vasorin/SLIT-like 2 Antibody (4G7) Summary

VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
SLITL2 - slit-like 2 (Drosophila) (4G7)
IgG2a Kappa
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Read Publication using H00114990-M05.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Vasorin/SLIT-like 2 Antibody (4G7)

  • Atia
  • Protein slit-like 2
  • SLIT like 2
  • Slitl2
  • slit-like 2 (Drosophila)
  • slit-like 2
  • VASN
  • Vasorin


May act as an inhibitor of TGF-beta signaling.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for Vasorin/SLIT-like 2 Antibody (H00114990-M05)(1)

Reviews for Vasorin/SLIT-like 2 Antibody (H00114990-M05) (0)

There are no reviews for Vasorin/SLIT-like 2 Antibody (H00114990-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vasorin/SLIT-like 2 Antibody (H00114990-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Vasorin/SLIT-like 2 Products

Bioinformatics Tool for Vasorin/SLIT-like 2 Antibody (H00114990-M05)

Discover related pathways, diseases and genes to Vasorin/SLIT-like 2 Antibody (H00114990-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vasorin/SLIT-like 2 Antibody (H00114990-M05)

Discover more about diseases related to Vasorin/SLIT-like 2 Antibody (H00114990-M05).

Pathways for Vasorin/SLIT-like 2 Antibody (H00114990-M05)

View related products by pathway.

PTMs for Vasorin/SLIT-like 2 Antibody (H00114990-M05)

Learn more about PTMs related to Vasorin/SLIT-like 2 Antibody (H00114990-M05).

Research Areas for Vasorin/SLIT-like 2 Antibody (H00114990-M05)

Find related products by research area.

Blogs on Vasorin/SLIT-like 2

There are no specific blogs for Vasorin/SLIT-like 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Vasorin/SLIT-like 2 Antibody (4G7) and receive a gift card or discount.


Gene Symbol VASN