We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Vanin-1/VNN1 Recombinant Protein Antigen

Images

 
There are currently no images for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Vanin-1/VNN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vanin-1/VNN1

Source: E.coli

Amino Acid Sequence: VFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
VNN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25222It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vanin-1/VNN1 Recombinant Protein Antigen

  • EC 3.5.1
  • EC 3.5.1.92
  • HDLCQ8
  • MGC116930
  • MGC116931
  • MGC116932
  • Pantetheinase
  • Pantetheine hydrolase
  • Tiff66
  • Tiff66MGC116933
  • vanin 1
  • Vanin1
  • Vanin-1
  • vannin 1
  • Vascular non-inflammatory molecule 1
  • VNN1

Background

VNN1 encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. This protein, like its mouse homolog, is likely a GPI-anchored cell surface molecule. The mouse protein is expressed by the perivascular thymic stromal cells and regulates migration of T-cell progenitors to the thymus. This gene lies in close proximity to, and in the same transcriptional orientation as, two other vanin genes on chromosome 6q23-q24. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79906
Species: Hu
Applications: WB
NBP2-90315
Species: Hu
Applications: ELISA, IHC,  IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-81875
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DY1857
Species: Mu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-87809
Species: Hu
Applications: IHC,  IHC-P

Publications for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP) (0)

There are no publications for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP) (0)

There are no reviews for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vanin-1/VNN1 Products

Research Areas for Vanin-1/VNN1 Recombinant Protein Antigen (NBP3-25222PEP)

Find related products by research area.

Blogs on Vanin-1/VNN1

There are no specific blogs for Vanin-1/VNN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vanin-1/VNN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VNN1