Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vanilloid R-like 3/TRPV3.

  Source: E. coli

  Amino Acid Sequence: EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TRPV3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57314.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen

• transient receptor potential cation channel subfamily V member 3
• transient receptor potential cation channel, subfamily V, member 3
• TRPV3
• vanilloid receptor 3
• Vanilloid receptor-like 3
• vanilloid receptor-related osmotically activated channel protein
• Vanilloid R-like 3
• VanilloidR like 3
• VanilloidR-like3
• VRL3
• VRL-3

Background

Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRPV3