Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen

Images

 
There are currently no images for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vanilloid R-like 3/TRPV3.

Source: E. coli

Amino Acid Sequence: EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRPV3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen

  • transient receptor potential cation channel subfamily V member 3
  • transient receptor potential cation channel, subfamily V, member 3
  • TRPV3
  • vanilloid receptor 3
  • Vanilloid receptor-like 3
  • vanilloid receptor-related osmotically activated channel protein
  • Vanilloid R-like 3
  • VanilloidR like 3
  • VanilloidR-like3
  • VRL3
  • VRL-3

Background

Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32096
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-33063
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC,  IHC-P, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF5708
Species: Hu
Applications: ICC, WB
NBP2-88493
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP) (0)

There are no publications for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP) (0)

There are no reviews for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vanilloid R-like 3/TRPV3 Products

Research Areas for Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP)

Find related products by research area.

Blogs on Vanilloid R-like 3/TRPV3

There are no specific blogs for Vanilloid R-like 3/TRPV3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV3