Home » Vanilloid R-like 3/TRPV3 » Vanilloid R-like 3/TRPV3 Proteins » Recombinant Human Vanilloid R-like 3/TRPV3 Protein

Recombinant Human Vanilloid R-like 3/TRPV3 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human Vanilloid R-like 3/TRPV3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 681-790 of Human Vanilloid R-like 3/TRPV3

Source: Wheat Germ

Amino Acid Sequence: VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPV3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Vanilloid R-like 3/TRPV3 Protein

  • transient receptor potential cation channel subfamily V member 3
  • transient receptor potential cation channel, subfamily V, member 3
  • TRPV3
  • vanilloid receptor 3
  • Vanilloid receptor-like 3
  • vanilloid receptor-related osmotically activated channel protein
  • Vanilloid R-like 3
  • VRL3
  • VRL-3

Background

TRPV3 - transient receptor potential cation channel, subfamily V, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Vanilloid R1/TRPV1
Antibody
NB100-1617
Immunocytochemistry/Immunofluorescence: Vanilloid R1/TRPV1 Antibody [NB100-1617] - CGRP and TRPV1 are co-expressed in most cultured trigeminal ganglion neurons. (A and C) CGRP expression in d2 trigeminal ganglion neurons plated on poly-d-lysine-coated coverslips. (B and D) The same culture shown in panel A or C costained for TRPV1 expression. Magnification bar = 200m (A and B) or 40m (C and D)
Immunohistochemistry: Vanilloid R1/TRPV1 Antibody [NB100-1617] - TRPV1 Antibody [NB100-1617] - Dorsal Root Ganglion
Immunocytochemistry/Immunofluorescence: Vanilloid R1/TRPV1 Antibody [NB100-1617] - TRPV1 staining in rat trigeminal ganglion. Image courtesy of Dr. Norman Capra, University of Maryland
(16 Publications)
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TRPV4 Antibody
NB110-74960
Western Blot: TRPV4 Antibody [NB110-74960] - WB on mouse brain lysate (reduced, denatured) using Rabbit antibody to TRPV4 at 1 : 1000 dilution.
Immunohistochemistry-Paraffin: TRPV4 Antibody [NB110-74960] - Rat kidney using Rabbit antibody to TRPV4, dilution 1: 1000, incubated 30 min at RT (using Autostainer).
Immunohistochemistry-Paraffin: TRPV4 Antibody [NB110-74960] - Rat kidney using Rabbit antibody to TRPV4, dilution 1: 1000, incubated 30 min at RT (using Autostainer)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TBP like protein
TLP Antibody
NBP1-31133
Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:2000.
Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP1-31133] - NT2D1 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TLP protein stained by TLP antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP1-31133] - Paraffin-embedded mouse lung. TLP antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in human cell line SK-MEL-30.
Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining in human skin and pancreas tissues using anti-TYRP1 antibody. Corresponding TYRP1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
VRL1 Antibody
NBP1-32096
Western Blot: VRL1 Antibody [NBP1-32096] - Sample (30 ug of whole cell lysate) A: NIH-3T3 7.5% SDS PAGE VRL1 antibody diluted at 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: VRL1 Antibody [NBP1-32096] - 293T cells transfected with vector, pCMV5 3xFlag-mCherry, as positive control. mCherry was co-localized with Flag. 293T cells transfected with vector, pCMV5 3xFlag-TRPV2, as experimental group. TRPV2 was co-localized with Flag at cell membrane. ICC Flag: green TRPV2: red Nucleus: blue mCherry: red fluorescent protein
Immunohistochemistry-Paraffin: VRL1 Antibody [NBP1-32096] - Analysis of paraffin-embedded human lung, using VRL1 antibody(10 ug/ml).
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
TRPM8 Antibody
NBP1-97311
Western Blot: TRPM8 Antibody [NBP1-97311] - WB analysis of TRPM8 in PC12 cell lysate.
Immunocytochemistry/Immunofluorescence: TRPM8 Antibody [NBP1-97311] - TRPM8 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: TRPM8 Antibody [NBP1-97311] - IHC analysis of TRPM8 in mouse prostate using DAB with hematoxylin counterstain.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TRPA1 Antibody
NB110-40763
Western Blot: TRPA1 Antibody [NB110-40763] - Detection of TRPA1 in human brain membrane fraction using 2ug/ml of NB110-40763.
Immunocytochemistry/Immunofluorescence: TRPA1 Antibody [NB110-40763] - IF analysis of TRPA1 in HEK 293 cells (Flp In Trex system) cells.
Immunohistochemistry: TRPA1 Antibody [NB110-40763] - Staining TRPA1 in mouse intestine.
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
TRPV6 Antibody
NBP1-74138
Western Blot: TRPV6 Antibody [NBP1-74138] - Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-rabbit-AP Secondary Dilution: 1:2000 Image Submitted by: Brian Kennedy Indiana University Northwest
Immunocytochemistry/Immunofluorescence: TRPV6 Antibody [NBP1-74138] - hRetinal pigment epithelial cells Green: primary Red: nuclear Primary Dilution: 1:200 Secondary Antibody: goat anti-rabbit-Alexa 488 Secondary Dilution: 1:500 Image Submitted by: Brian Kennedy Indiana University Northwest
Western Blot: TRPV6 Antibody [NBP1-74138] - Rat Brain Lysate 1ug/ml Gel Concentration 12%
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
TRPV5 Antibody
NB100-93520
Western Blot: TRPV5 Antibody [NB100-93520] - (1ug/ml) staining of Human Pancreas lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
TRPM7 Antibody
NBP2-58525
Immunocytochemistry/Immunofluorescence: TRPM7 Antibody [NBP2-58525] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRPM7 Antibody [NBP2-58525] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: TRPM7 Antibody [NBP2-58525] - Analysis in human parathyroid gland and pancreas tissues using Anti-TRPM7 antibody. Corresponding TRPM7 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TRPM4 Antibody
(OTI10H5)
NBP1-48036
Western Blot: TRPM4 Antibody (10H5) [NBP1-48036] Analysis of extracts (35ug) from 9 different cell lines by using anti-TRPM4 monoclonal antibody.
Immunohistochemistry-Paraffin: TRPM4 Antibody (10H5) [NBP1-48036] - Staining of paraffin-embedded Human pancreas tissue using anti-TRPM4 mouse monoclonal antibody.
Western Blot: TRPM4 Antibody (10H5) [NBP1-48036] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TRPM4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TRPM4.
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
TRPM3 Antibody
NB100-98864
TRPM3 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TRPM2 Antibody
NB110-81601
Western Blot: TRPM2 Antibody [NB110-81601] - Lane 1: CHO cells untransfected. Lane 2: CHO cell transfected with rat TRPM2 Lane 3: Mouse cortical neurons (cultured) Photo courtesy of Dr. Paco Herson, Oregon Health & Science University.
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-TRPM2 at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Staining of rat hippocampus using NB110-81601. TRPM2 is stained red, GFAP is stained green and nuclei staining is blue. Photo courtesy of Dr. Ji-Zhong Bai, The University of Auckland, New Zealand.
(8 Publications)
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Hairless Antibody
[Unconjugated]
AF5708
Western blot shows lysates of HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Hairless at approximately 96 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Hairless was detected in immersion fixed human NHEK epidermal keratinocytes using 10 µg/mL Goat Anti-Human Hairless Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5708) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, ICC
TRPM5 Antibody
NB100-98867
TRPM5 Antibody
(1 Publication)
Species: Rt
Applications: WB, IHC
TRPM6 RNAi
H00140803-R03
Species: Hu

Publications for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no publications for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no reviews for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Discover related pathways, diseases and genes to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Discover more about diseases related to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).
 

Pathways for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

View related products by pathway.

PTMs for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Learn more about PTMs related to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).

Blogs on Vanilloid R-like 3/TRPV3

There are no specific blogs for Vanilloid R-like 3/TRPV3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen
NBP2-57314PEP
Western Blot: TRPA1 Antibody [NB110-40763] - Detection of TRPA1 in human brain membrane fraction using 2ug/ml of NB110-40763.
TRPA1 Antibody
NB110-40763
Western Blot: Vanilloid R-like 3/TRPV3 Antibody (S15-39) [NBP2-12918] - analysis of Rat brain membrane lysate showing detection of TrpV3 protein using Mouse Anti-TrpV3 Monoclonal Antibody, Clone S15-39. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-TrpV3 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Vanilloid R-like 3/TRPV3 Antibody (S15-39)
NBP2-12918
Immunocytochemistry/Immunofluorescence: Vanilloid R1/TRPV1 Antibody [NB100-1617] - CGRP and TRPV1 are co-expressed in most cultured trigeminal ganglion neurons. (A and C) CGRP expression in d2 trigeminal ganglion neurons plated on poly-d-lysine-coated coverslips. (B and D) The same culture shown in panel A or C costained for TRPV1 expression. Magnification bar = 200m (A and B) or 40m (C and D)
Vanilloid R1/TRPV1 Antibody
NB100-1617

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Vanilloid R-like 3/TRPV3 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TRPV3
Entrez