Recombinant Human Vanilloid R-like 3/TRPV3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Vanilloid R-like 3/TRPV3 Protein Summary

Description
Vanilloid R-like 3/TRPV3 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRPV3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Vanilloid R-like 3/TRPV3 Protein

  • transient receptor potential cation channel subfamily V member 3
  • transient receptor potential cation channel, subfamily V, member 3
  • TRPV3
  • vanilloid receptor 3
  • Vanilloid receptor-like 3
  • vanilloid receptor-related osmotically activated channel protein
  • Vanilloid R-like 3
  • VRL3
  • VRL-3

Background

TRPV3 - transient receptor potential cation channel, subfamily V, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB100-810
Species: Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-48036
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF5708
Species: Hu
Applications: WB, IHC, ICC
NB100-98867
Species: Rt
Applications: WB, IHC
H00140803-R03
Species: Hu
H00162514-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no publications for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no reviews for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vanilloid R-like 3/TRPV3 Products

Bioinformatics Tool for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Discover related pathways, diseases and genes to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Discover more about diseases related to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).
 

Pathways for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

View related products by pathway.

PTMs for Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01)

Learn more about PTMs related to Vanilloid R-like 3/TRPV3 Partial Recombinant Protein (H00162514-Q01).

Blogs on Vanilloid R-like 3/TRPV3

There are no specific blogs for Vanilloid R-like 3/TRPV3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRPA1 Antibody
NB110-40763
TRPA1 Antibody
NB110-40763
TRPA1 Antibody
NB110-40763

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Vanilloid R-like 3/TRPV3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV3
Entrez