Recombinant Human VAMP3/Cellubrevin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VAMP3/Cellubrevin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human VAMP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
VAMP3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VAMP3/Cellubrevin Protein

  • CEBCellubrevin
  • cellubrevin
  • SYB3
  • Synaptobrevin-3
  • VAMP-3
  • vesicle-associated membrane protein 3 (cellubrevin)
  • vesicle-associated membrane protein 3

Background

VAMP3( AAH03570, 1 a.a. - 101 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5354
Species: Hu
Applications: WB, IHC
AF4828
Species: Hu, Mu
Applications: WB, IHC
NBP2-15131
Species: Hu
Applications: WB
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF6386
Species: Hu
Applications: WB, IP
H00009341-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01) (0)

There are no publications for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01) (0)

There are no reviews for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VAMP3/Cellubrevin Products

Bioinformatics Tool for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01)

Discover related pathways, diseases and genes to VAMP3/Cellubrevin Recombinant Protein (H00009341-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01)

Discover more about diseases related to VAMP3/Cellubrevin Recombinant Protein (H00009341-P01).
 

Pathways for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01)

View related products by pathway.

PTMs for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01)

Learn more about PTMs related to VAMP3/Cellubrevin Recombinant Protein (H00009341-P01).
 

Research Areas for VAMP3/Cellubrevin Recombinant Protein (H00009341-P01)

Find related products by research area.

Blogs on VAMP3/Cellubrevin

There are no specific blogs for VAMP3/Cellubrevin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VAMP3/Cellubrevin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VAMP3