USP6 Antibody (1F5) - Azide and BSA Free

ELISA: USP6 Antibody (1F5) [H00009098-M01] - Detection limit for recombinant GST tagged USP6 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

USP6 Antibody (1F5) - Azide and BSA Free Summary

• Immunogen: USP6 (NP_004496, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH
• Specificity: USP6 (1F5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: USP6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP6 Antibody (1F5) - Azide and BSA Free

• Deubiquitinating enzyme 6
• EC 3.1.2.15
• EC 3.4.19.12
• HRP1
• hyperpolymorphic gene 1
• Proto-oncogene TRE-2
• TRE17
• tre-2 oncogene
• TRE2
• Tre-2
• TRE2USP6-short
• ubiquitin carboxyl-terminal hydrolase 6
• ubiquitin specific peptidase 6 (Tre-2 oncogene)
• ubiquitin specific peptidase 6-
• ubiquitin specific protease 6 (Tre-2 oncogene)
• ubiquitin thioesterase 6
• Ubiquitin thiolesterase 6
• ubiquitin-specific protease USP6
• Ubiquitin-specific-processing protease 6
• USP6

Background

GenBank Accession Number -P_004496. Gene Ontology terms - lysosomal cysteine-type endopeptidase; nucleic acid binding; deubiquitination; oncogenesis; protein modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP6
• Entrez:
  • 9098(Human)
• OMIM:
  • 604334(Human)
• Uniprot:
  • NP_004496(Human)