USP49 Antibody - BSA Free

Western Blot: USP49 Antibody [NBP1-81173] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-624

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP49 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP49 Antibody - BSA Free (NBP1-81173) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQKQDTPVRRGRTLRSMASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALERK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP49
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  USP49 Protein (NBP1-81173PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for USP49 Antibody - BSA Free

• Deubiquitinating enzyme 49
• EC 3.1.2.15
• EC 3.4.19.12
• MGC20741
• ubiquitin carboxyl-terminal hydrolase 49
• ubiquitin specific peptidase 49
• ubiquitin specific protease 49
• ubiquitin thioesterase 49
• Ubiquitin thiolesterase 49
• Ubiquitin-specific-processing protease 49
• USP49

Background

USP49 - ubiquitin specific protease 49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP49
• Entrez:
  • 25862(Human)
• Uniprot:
  • Q70CQ1(Human)