USP48 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

USP48 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP48.
  
  

  Source: E. coli

  Amino Acid Sequence: QEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: USP48
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83751.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP48 Recombinant Protein Antigen

• Deubiquitinating enzyme 48
• DKFZp762M1713
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ11328
• FLJ20103
• FLJ23054
• FLJ23277
• MGC132556
• MGC14879
• RAP1GA1
• synUSP
• ubiquitin carboxyl-terminal hydrolase 48
• ubiquitin specific peptidase 48
• ubiquitin specific protease 31
• ubiquitin specific protease 48
• ubiquitin thioesterase 48
• Ubiquitin thiolesterase 48
• Ubiquitin-specific-processing protease 48
• USP31
• USP48

Background

The conjugation of ubiquitin to proteins is an important means to regulate protein activity for many cellular processes by tagging them for degradation. Removal of Ub can rescue proteins from degradation. This is accomplished by the ubiquitin-specific processing protease (UBP) family of enzymes. Ubiquitin specific peptidase 48 (USP48) is a member of the C19 peptidase family involved in the processing of polyubiquitin precursors as well as that of ubiquitinated proteins. USP48 is involved in the activation of NF-kappa B via its interaction with RELA and TRAF2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: USP48