USP37 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP37 Antibody [NBP1-82901] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: USP37 Antibody [NBP1-82901] - Staining of human hippocampus shows distinct cytoplasmic positivity in astrocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP37 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP37 Protein (NBP1-82901PEP)
Publications
Read Publication using NBP1-82901.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP37 Antibody

  • Deubiquitinating enzyme 37
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1594tmp_locus_50
  • MGC117261
  • ubiquitin carboxyl-terminal hydrolase 37
  • ubiquitin specific peptidase 37
  • ubiquitin specific protease 37
  • ubiquitin thioesterase 37
  • Ubiquitin thiolesterase 37
  • Ubiquitin-specific-processing protease 37
  • USP37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-30447
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for USP37 Antibody (NBP1-82901)(1)

Reviews for USP37 Antibody (NBP1-82901) (0)

There are no reviews for USP37 Antibody (NBP1-82901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP37 Antibody (NBP1-82901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP37 Products

Bioinformatics Tool for USP37 Antibody (NBP1-82901)

Discover related pathways, diseases and genes to USP37 Antibody (NBP1-82901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP37 Antibody (NBP1-82901)

Discover more about diseases related to USP37 Antibody (NBP1-82901).
 

Pathways for USP37 Antibody (NBP1-82901)

View related products by pathway.

PTMs for USP37 Antibody (NBP1-82901)

Learn more about PTMs related to USP37 Antibody (NBP1-82901).
 

Research Areas for USP37 Antibody (NBP1-82901)

Find related products by research area.

Blogs on USP37

There are no specific blogs for USP37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP37
Entrez