USP35 Antibody

Images

 
Immunohistochemistry-Paraffin: USP35 Antibody [NBP2-32393] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP35 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USP35 Protein (NBP2-32393PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP35 Antibody

  • Deubiquitinating enzyme 35
  • EC 3.4.19.12
  • KIAA1372
  • ubiquitin carboxyl-terminal hydrolase 35
  • ubiquitin specific peptidase 35
  • ubiquitin specific protease 35
  • ubiquitin thioesterase 35
  • Ubiquitin thiolesterase 35
  • Ubiquitin-specific-processing protease 35
  • USP34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP2-58363
Species: Hu
Applications: ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00079075-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88934
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for USP35 Antibody (NBP2-32393) (0)

There are no publications for USP35 Antibody (NBP2-32393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP35 Antibody (NBP2-32393) (0)

There are no reviews for USP35 Antibody (NBP2-32393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for USP35 Antibody (NBP2-32393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP35 Products

USP35 NBP2-32393

Bioinformatics Tool for USP35 Antibody (NBP2-32393)

Discover related pathways, diseases and genes to USP35 Antibody (NBP2-32393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP35 Antibody (NBP2-32393)

Discover more about diseases related to USP35 Antibody (NBP2-32393).

Blogs on USP35

There are no specific blogs for USP35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP35