USMG5 Antibody


Western Blot: USMG5 Antibody [NBP1-91361] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

USMG5 Antibody Summary

Synthetic peptide directed towards the N terminal of human USMG5. Peptide sequence MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against USMG5 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USMG5 Antibody

  • up-regulated during skeletal muscle growth 5 homolog (mouse)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for USMG5 Antibody (NBP1-91361) (0)

There are no publications for USMG5 Antibody (NBP1-91361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USMG5 Antibody (NBP1-91361) (0)

There are no reviews for USMG5 Antibody (NBP1-91361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USMG5 Antibody (NBP1-91361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional USMG5 Products

Bioinformatics Tool for USMG5 Antibody (NBP1-91361)

Discover related pathways, diseases and genes to USMG5 Antibody (NBP1-91361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USMG5 Antibody (NBP1-91361)

Discover more about diseases related to USMG5 Antibody (NBP1-91361).

Pathways for USMG5 Antibody (NBP1-91361)

View related products by pathway.

PTMs for USMG5 Antibody (NBP1-91361)

Learn more about PTMs related to USMG5 Antibody (NBP1-91361).

Blogs on USMG5

There are no specific blogs for USMG5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our USMG5 Antibody and receive a gift card or discount.


Gene Symbol USMG5
Novus 100% Guarantee