clarin 1 Antibody


Western Blot: clarin 1 Antibody [NBP1-69142] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

clarin 1 Antibody Summary

Synthetic peptides corresponding to CLRN1 (clarin 1) The peptide sequence was selected from the C terminal of CLRN1. Peptide sequence QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CLRN1 and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for clarin 1 Antibody

  • clarin 1
  • clarin-1
  • USH3
  • USH3AUsher syndrome type-3 protein
  • Usher syndrome 3A


This gene encodes a protein that contains a cytosolic N-terminus, multiple helical transmembrane domains, and an endoplasmic reticulum membrane retention signal, TKGH, in the C-terminus. The encoded protein may be important in development and homeostasis of the inner ear and retina. Mutations within this gene have been associated with Usher syndrome type IIIa. Multiple transcript variants encoding distinct isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Eq
Applications: WB, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu
Applications: WB

Publications for clarin 1 Antibody (NBP1-69142) (0)

There are no publications for clarin 1 Antibody (NBP1-69142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for clarin 1 Antibody (NBP1-69142) (0)

There are no reviews for clarin 1 Antibody (NBP1-69142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for clarin 1 Antibody (NBP1-69142) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional clarin 1 Products

clarin 1 NBP1-69142

Bioinformatics Tool for clarin 1 Antibody (NBP1-69142)

Discover related pathways, diseases and genes to clarin 1 Antibody (NBP1-69142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for clarin 1 Antibody (NBP1-69142)

Discover more about diseases related to clarin 1 Antibody (NBP1-69142).

Pathways for clarin 1 Antibody (NBP1-69142)

View related products by pathway.

PTMs for clarin 1 Antibody (NBP1-69142)

Learn more about PTMs related to clarin 1 Antibody (NBP1-69142).

Research Areas for clarin 1 Antibody (NBP1-69142)

Find related products by research area.

Blogs on clarin 1

There are no specific blogs for clarin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our clarin 1 Antibody and receive a gift card or discount.


Gene Symbol CLRN1