Uroplakin Ib Antibody (4F4)

Images

 
ELISA: Uroplakin Ib Antibody (4F4) [H00007348-M05] - Detection limit for recombinant GST tagged UPK1B is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Uroplakin Ib Antibody (4F4) Summary

Immunogen
UPK1B (NP_008883, 131 a.a. - 228 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UPK1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Uroplakin Ib Antibody (4F4)

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is found in the asymmetrical unit membrane (AUM) where it can form a complex with other transmembrane 4 superfamily proteins. It may play a role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions. The use of alternate polyadenylation sites has been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-12482
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBL1-15012
Species: Hu
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00007348-M05
Species: Hu
Applications: WB, ELISA

Publications for Uroplakin Ib Antibody (H00007348-M05) (0)

There are no publications for Uroplakin Ib Antibody (H00007348-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uroplakin Ib Antibody (H00007348-M05) (0)

There are no reviews for Uroplakin Ib Antibody (H00007348-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uroplakin Ib Antibody (H00007348-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uroplakin Ib Products

Bioinformatics Tool for Uroplakin Ib Antibody (H00007348-M05)

Discover related pathways, diseases and genes to Uroplakin Ib Antibody (H00007348-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin Ib Antibody (H00007348-M05)

Discover more about diseases related to Uroplakin Ib Antibody (H00007348-M05).
 

Pathways for Uroplakin Ib Antibody (H00007348-M05)

View related products by pathway.

PTMs for Uroplakin Ib Antibody (H00007348-M05)

Learn more about PTMs related to Uroplakin Ib Antibody (H00007348-M05).

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uroplakin Ib Antibody (4F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol UPK1B
Entrez
Uniprot