Uroplakin Ia Antibody

Immunohistochemistry-Paraffin: Uroplakin Ia Antibody [NBP2-14694] - Staining in human urinary bladder and endometrium tissues using anti-UPK1A antibody. Corresponding UPK1A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Frozen: Uroplakin Ia Antibody [NBP2-14694] - Staining in mouse adult and embryonic bladder tissue. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Uroplakin Ia Antibody [NBP2-14694] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: Uroplakin Ia Antibody [NBP2-14694] - Staining of human urinary bladder shows high expression.

Product Discontinued

Uroplakin Ia Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFT
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UPK1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Uroplakin antibody validated for IHC-frozen from a verified customer review.

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Uroplakin Ia Antibody

• TSPAN21
• UP1A
• UPIA
• UPK1A uroplakin 1A
• UPK1A
• UPKA
• Uroplakin Ia

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Uroplakin Ia Antibody (NBP2-14694)(1)

Publication using NBP2-14694

• Ceccarelli TJ Chga-Depleted Urothelial Amp and Immune Response During Urinary Tract Infection Thesis 1905-07-13

Review for Uroplakin Ia Antibody (NBP2-14694) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Lisa Ikariyama IHC-Fr Mouse 05/18/2017

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Adult bladder tissue – frozen,Embryonic bladder tissue – frozen
• Species: Mouse

Bioinformatics

• Gene Symbol: UPK1A