Uridine Phosphorylase 1/UPP1 Antibody


Western Blot: Uridine Phosphorylase 1/UPP1 Antibody [NBP1-55354] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Uridine Phosphorylase 1/UPP1 Antibody Summary

Synthetic peptide directed towards the N terminal of human UPP1(NP_003355). Peptide sequence AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against UPP1 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Uridine Phosphorylase 1/UPP1 Antibody

  • EC
  • UP
  • UPASE 1
  • UPP
  • UPP1
  • UPUPase 1
  • UrdPase 1
  • uridine phosphorylase 1
  • uridine phosphorylase


UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB

Publications for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354) (0)

There are no publications for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354) (0)

There are no reviews for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354). (Showing 1 - 1 of 1 FAQ).

  1. What is the recommended blocking solution when using NBP1-55354 (UPP1 antibody) for Western blotting (ie Milk vs BSA)?
    • For this particular antibody (NBP1-55354) we would recommend using 5% non-fat dry milk in 1x PBST or TBST, pH 7.4 as your blocking buffer. 

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354)

Discover related pathways, diseases and genes to Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354)

Discover more about diseases related to Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354).

Pathways for Uridine Phosphorylase 1/UPP1 Antibody (NBP1-55354)

View related products by pathway.

Blogs on Uridine Phosphorylase 1/UPP1

There are no specific blogs for Uridine Phosphorylase 1/UPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Uridine Phosphorylase 1/UPP1 Antibody and receive a gift card or discount.


Gene Symbol UPP1