Home » URB/CCD80 » URB/CCD80 Proteins » URB/CCD80 Recombinant Protein Antigen

URB/CCD80 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for URB/CCD80 Protein (NBP1-87965PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

URB/CCD80 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC80.

Source: E.coli

Amino Acid Sequence: MMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKVRRITSEGQILEQPLDPSLIPKLMSFLKLEKGKFGMVLLKKTLQVEERYPYPVRLEAMYEVIDQGPIRRIEKIRQKGFVQKCKASGVEGQVVAEGNDGGG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCDC80
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87965.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for URB/CCD80 Recombinant Protein Antigen

  • CCDC80
  • coiled-coil domain containing 80
  • down-regulated by oncogenes protein 1
  • DRO1
  • SSG1
  • Steroid-sensitive protein 1
  • URB

Background

CCD80 is expressed in dermal papilla and dermal fibroblasts (at protein level) and in heart, thymus, placenta, pancreas, colon, epithelium, spleen and osteoblasts. There are three named isoforms produced by alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
SRPX Antibody -
BSA Free
NBP1-77086
Immunocytochemistry/Immunofluorescence: SRPX Antibody [NBP1-77086] - Immunofluorescence of SRPX1 in human brain tissue with SRPX1 antibody at 20 ug/mL.
Western Blot: SRPX Antibody [NBP1-77086] - SK-N-SH cell lysate with SRPX antibody at 0.25 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: SRPX Antibody [NBP1-77086] - Human brain tissue with SRPX antibody at 5 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(19 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
CEBP alpha
Antibody (5B7)
NBP2-37497
ELISA: CEBP alpha Antibody (5B7) [NBP2-37497] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CEBP alpha Antibody (5B7) [NBP2-37497] - Western blot analysis using CEBPA mouse mAb against Jurkat (1), k562 (2), and HepG2 (3) cell lysate.
Immunocytochemistry/Immunofluorescence: CEBP alpha Antibody (5B7) [NBP2-37497] - Immunofluorescence analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
BMAL1 Antibody
NB100-2288
Flow (Intracellular): BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on HeLa cells with NB100-2288AF647(blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunohistochemistry: BMAL1 Antibody [NB100-2288] - Analysis of BMAL1 in mouse cerebral cortex (left: wt, right: Bmal1 KO) using anti-BMAL1 antibody. Image from verified customer review.
Flow Cytometry: BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on Jurkat cells with NB100-2288 and a matched isotype control. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(1 Review)
(41 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(741 Publications)
Species: Hu
Applications: BA
CCL2/JE/MCP-1 [HRP]
DCP00
(238 Publications)
Species: Hu
Applications: ELISA
Adiponectin/Acrp30
[HRP]
DRP300
(166 Publications)
Species: Hu
Applications: ELISA
FMNL1 Antibody
NBP1-33431
Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-33431] - Paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
Western Blot: FMNL1 Antibody [NBP1-33431] - H1299 lysates (Lane A) and Hela cells (Lane B) using NBP1-33431 at a dilution of 1:1000. 30ug whole cell lysate loaded on 7.5% SDS PAGE gel.
Western Blot: FMNL1 Antibody [NBP1-33431] - Sample (30 ug of whole cell lysate) A: Raji 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
SRPX2 Antibody -
BSA Free
NBP1-77370
Immunocytochemistry/Immunofluorescence: SRPX2 Antibody [NBP1-77370] - Immunofluorescence of SRPX2 in human lung tissue with SRPX2 antibody at 20 ug/mL.
Western Blot: SRPX2 Antibody [NBP1-77370] - Human lung tissue lysate with SRPX2 antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: SRPX2 Antibody [NBP1-77370] - Rat lung tissue with SRPX2 antibody at 5 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FMNL2 Antibody
NBP2-24748
Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Analysisof human brain, cortex using this antibody at 10 ug/ml.
Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Staining of normal human brain using this antibody (FMNL2, figure A and control rabbit Ig, figure B) at 6 ug/ml.
Western Blot: FMNL2 Antibody [NBP2-24748] - Analysis of Formin-like protein 2 in whole mouse embryo body tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 2 ug/ml.
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
BTF Antibody
NBP2-24859
Immunocytochemistry/Immunofluorescence: BTF Antibody [NBP2-24859] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BTF at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: BTF Antibody [NBP2-24859] - Total protein from human A431 and U2Os cells and mouse 3T3 and Neuro2A cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-BTF (NBP2-24859) in blocking buffer and detected with an anti-rabbit HRP secondary antibody using NovaLume Chemiluminescent detection reagent (NBP2-61915)
Immunocytochemistry/Immunofluorescence: BTF Antibody [NBP2-24859] - NIH3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BTF at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY HSD17B4.
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of HeLa cells.
Immunohistochemistry: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining (0.3ug/ml) of Jurkat (A) and (0.5ug/ml) HepG2 (B) cell lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear, membrane and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry: D Box Binding Protein Antibody [NBP2-83997] - Human Liver
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - WB Suggested Anti-DBP Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - Host: Rabbit. Target Name: DBP. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Species: Hu
Applications: IHC, IHC-P, WB
URB/CCD80
Recombinant Protein A
NBP1-87965PEP
URB/CCD80 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for URB/CCD80 Protein (NBP1-87965PEP) (0)

There are no publications for URB/CCD80 Protein (NBP1-87965PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for URB/CCD80 Protein (NBP1-87965PEP) (0)

There are no reviews for URB/CCD80 Protein (NBP1-87965PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for URB/CCD80 Protein (NBP1-87965PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional URB/CCD80 Products

Bioinformatics Tool for URB/CCD80 Protein (NBP1-87965PEP)

Discover related pathways, diseases and genes to URB/CCD80 Protein (NBP1-87965PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for URB/CCD80 Protein (NBP1-87965PEP)

Discover more about diseases related to URB/CCD80 Protein (NBP1-87965PEP).
 

Pathways for URB/CCD80 Protein (NBP1-87965PEP)

View related products by pathway.

Blogs on URB/CCD80

There are no specific blogs for URB/CCD80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our URB/CCD80 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CCDC80