UNK Antibody

Images

 
Western Blot: UNK Antibody [NBP2-86041] - Host: Rabbit. Target Name: UNK. Sample Type: Lung Tumor. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNK Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNK. Peptide sequence: DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
UNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UNK Antibody

  • UNK unkempt homolog (Drosophila)
  • ZC3H5
  • ZC3HDC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB1936
Species: Hu
Applications: IP, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
6056-MC
Species: Hu
Applications: BA
664-LI/CF
Species: Hu
Applications: BA
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB35661
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-86041
Species: Hu
Applications: WB

Publications for UNK Antibody (NBP2-86041) (0)

There are no publications for UNK Antibody (NBP2-86041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNK Antibody (NBP2-86041) (0)

There are no reviews for UNK Antibody (NBP2-86041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNK Antibody (NBP2-86041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNK Products

Array NBP2-86041

Bioinformatics Tool for UNK Antibody (NBP2-86041)

Discover related pathways, diseases and genes to UNK Antibody (NBP2-86041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNK Antibody (NBP2-86041)

Discover more about diseases related to UNK Antibody (NBP2-86041).
 

Pathways for UNK Antibody (NBP2-86041)

View related products by pathway.

PTMs for UNK Antibody (NBP2-86041)

Learn more about PTMs related to UNK Antibody (NBP2-86041).

Blogs on UNK

There are no specific blogs for UNK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNK