ULK4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ULK4 Antibody [NBP1-84739] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ULK4 Antibody [NBP1-84739] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ULK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ULK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ULK4 Protein (NBP1-84739PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ULK4 Antibody

  • DKFZp434E1822
  • EC 2.7.11.1
  • FAM7C1
  • FLJ20574
  • REC01035
  • serine/threonine-protein kinase ULK4
  • unc-51-like kinase 4 (C. elegans)
  • Unc-51-like kinase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-45679
Species: Hu
Applications: WB, IHC, IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP1-85045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88242
Species: Hu
Applications: IHC, IHC-P
AF6739
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-92188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83515
Species: Hu
Applications: IHC, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83411
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ULK4 Antibody (NBP1-84739) (0)

There are no publications for ULK4 Antibody (NBP1-84739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ULK4 Antibody (NBP1-84739) (0)

There are no reviews for ULK4 Antibody (NBP1-84739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ULK4 Antibody (NBP1-84739). (Showing 1 - 1 of 1 FAQ).

  1. I want to ask the molecular size of ULK4?
    • In Western blot our ULK4 antibodies detect the target protein at 65kD.

Secondary Antibodies

 

Isotype Controls

Additional ULK4 Products

Bioinformatics Tool for ULK4 Antibody (NBP1-84739)

Discover related pathways, diseases and genes to ULK4 Antibody (NBP1-84739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ULK4 Antibody (NBP1-84739)

Discover more about diseases related to ULK4 Antibody (NBP1-84739).
 

Pathways for ULK4 Antibody (NBP1-84739)

View related products by pathway.

Research Areas for ULK4 Antibody (NBP1-84739)

Find related products by research area.

Blogs on ULK4

There are no specific blogs for ULK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ULK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ULK4