ULBP-1 Antibody

Immunohistochemistry-Paraffin: ULBP-1 Antibody [NBP1-80856] - Staining in human testis and prostate tissues using anti-ULBP1 antibody. Corresponding ULBP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ULBP-1 Antibody [NBP1-80856] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: ULBP-1 Antibody [NBP1-80856] - Staining of human prostate shows low expression as expected.

Product Discontinued

ULBP-1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ULBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 25854581). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25510288).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ULBP-1 Antibody

• ALCAN-beta
• MULT-1
• N2DL1
• N2DL-1
• NKG2D ligand 1
• NKG2DL
• NKG2DL1
• RAET1I
• RAET1Ialcan-beta
• Retinoic acid early transcript 1I
• UL16 binding protein 1
• UL16-binding protein 1
• ULBP1
• ULBP-1

Background

Ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked theinteraction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system.UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ULBP-1 Antibody (NBP1-80856)(6)

Publications using NBP1-80856

• Takahashi J, Mizutani T, Sugihara H et al. Suspension culture in a rotating bioreactor for efficient generation of human intestinal organoids Cell reports methods 2022-11-21 [PMID: 36452871] (IF/IHC, Human)
• Picardi A, Mengarelli A, Marino M et al. Up-regulation of activating and inhibitory NKG2 receptors in allogeneic and autologous hematopoietic stem cell grafts. J. Exp. Clin. Cancer Res. 2015-09-12 [PMID: 26361968] (IHC-P, Human)
• Boerman GH, van Ostaijen-ten Dam MM, Kraal KC et al. Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells. Cancer Immunol Immunother 2015-05-01 [PMID: 25854581] (IF/IHC, Human)
• Spada R, Rojas JM, Perez-Yague S et al. NKG2D ligand overexpression in lupus nephritis correlates with increased NK cell activity and differentiation in kidneys but not in the periphery J. Leukoc. Biol. 2015-03-01 [PMID: 25583577]
• Cho H, Chung JY, Kim S et al. MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer. BMC Cancer 2014-12-15 [PMID: 25510288] (IF/IHC, Human)
• de Kruijf EM, Sajet A, van Nes JG et al. NKG2D ligand tumor expression and association with clinical outcome in early breast cancer patients: an observational study. BMC Cancer 2012-01-01 [PMID: 22257486]

FAQs for ULBP-1 Antibody (NBP1-80856). (Showing 1 - 1 of 1 FAQs).

1. Our customer was interested in the ULBP antibodies with the Cat No. NBP1-80856 and NBP2-31866. However, it didn’t show clearly whether the NBP2-31866 was tested in IHC-P. In the datasheet, it just read immunochemistry. But there was a figure of IHC-P in the datasheet.
   • In answer to your question, NBP2-31866 was tested on paraffin-embedded tissues. I am very sorry that this was not detailed on our datasheet. I have requested that this change be made, and it should be reflected on the website in 24-48 hours.

Bioinformatics

• Gene Symbol: ULBP1
• Entrez:
  • 80329(Human)
• Uniprot:
  • Q9BZM6(Human)