UHRF1 Antibody (3A11)

Images

 
Western Blot: UHRF1 Antibody (3A11) [H00029128-M01] - UHRF1 monoclonal antibody (M01), clone 3A11 Analysis of UHRF1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: UHRF1 Antibody (3A11) [H00029128-M01] - Analysis of monoclonal antibody to UHRF1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: UHRF1 Antibody (3A11) [H00029128-M01] - Analysis of monoclonal antibody to UHRF1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
3A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UHRF1 Antibody (3A11) Summary

Immunogen
UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Specificity
UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UHRF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00029128-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UHRF1 Antibody (3A11)

  • E3 ubiquitin-protein ligase UHRF1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ21925
  • hNP95
  • huNp95
  • ICBP90NP95
  • Inverted CCAAT box-binding protein of 90 kDa
  • Np95
  • Nuclear protein 95
  • Nuclear zinc finger protein Np95
  • RING finger protein 106
  • RNF106MGC138707
  • Transcription factor ICBP90
  • Ubiquitin-like PHD and RING finger domain-containing protein 1
  • ubiquitin-like with PHD and ring finger domains 1
  • ubiquitin-like, containing PHD and RING finger domains, 1
  • Ubiquitin-like-containing PHD and RING finger domains protein 1

Background

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-94538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PLA, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-01367
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-18933
Species: Hu, Mu
Applications: IP, WB
DVE00
Species: Hu
Applications: ELISA
AF1709
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
PP-A8620A-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
H00029128-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for UHRF1 Antibody (H00029128-M01)(2)

Reviews for UHRF1 Antibody (H00029128-M01) (0)

There are no reviews for UHRF1 Antibody (H00029128-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UHRF1 Antibody (H00029128-M01). (Showing 1 - 1 of 1 FAQs).

  1. Could I please get the concentration of UHRF1 antibody (H00029128-M01)?
    • The concentration of lot CB191-3A11 is 0.5 mg/ml. The contraction of the newest lot, D6141-3A1, is 0.5 mg/ml. The typical concentration is 0.5 or 1 mg/ml depending on the lot.

Secondary Antibodies

 

Isotype Controls

Additional UHRF1 Products

Bioinformatics Tool for UHRF1 Antibody (H00029128-M01)

Discover related pathways, diseases and genes to UHRF1 Antibody (H00029128-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UHRF1 Antibody (H00029128-M01)

Discover more about diseases related to UHRF1 Antibody (H00029128-M01).
 

Pathways for UHRF1 Antibody (H00029128-M01)

View related products by pathway.

PTMs for UHRF1 Antibody (H00029128-M01)

Learn more about PTMs related to UHRF1 Antibody (H00029128-M01).
 

Research Areas for UHRF1 Antibody (H00029128-M01)

Find related products by research area.

Blogs on UHRF1.

Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation
By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UHRF1 Antibody (3A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol UHRF1
Entrez
OMIM
Uniprot