UGP2 Antibody (3H3)

Images

 
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in NIH/3T3.
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3 Analysis of UGP2 expression in HeLa.
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in PC-12.
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in Raw 264.7.
Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.Lane 1: UGP2 transfected lysate(56.9 KDa).Lane 2: ...read more
Sandwich ELISA: UGP2 Antibody (3H3) [H00007360-M01] - Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
3H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGP2 Antibody (3H3) Summary

Immunogen
UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Localization
Cytoplasmic
Specificity
UGP2 - UDP-glucose pyrophosphorylase 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGP2 Antibody (3H3)

  • EC 2.7.7.9
  • pHC379
  • UDPG
  • UDP-glucose diphosphorylase
  • UDP-glucose pyrophosphorylase 2
  • UDP-glucose pyrophosphorylase
  • UDPGP
  • UDPGP2
  • UGP1
  • UGPase 2
  • UGPase
  • UGPP2
  • uridyl diphosphate glucose pyrophosphorylase 2
  • UTP-glucose-1-phosphate uridyltransferase
  • UTP--glucose-1-phosphate uridylyltransferase 2
  • UTP--glucose-1-phosphate uridylyltransferase

Background

The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-61753
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32312
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85889
Species: Hu
Applications: WB
NB100-41419
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1793
Species: Hu, Mu, Rt, Pm
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00007360-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, RNAi, S-ELISA

Publications for UGP2 Antibody (H00007360-M01) (0)

There are no publications for UGP2 Antibody (H00007360-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGP2 Antibody (H00007360-M01) (0)

There are no reviews for UGP2 Antibody (H00007360-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGP2 Antibody (H00007360-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UGP2 Products

Bioinformatics Tool for UGP2 Antibody (H00007360-M01)

Discover related pathways, diseases and genes to UGP2 Antibody (H00007360-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGP2 Antibody (H00007360-M01)

Discover more about diseases related to UGP2 Antibody (H00007360-M01).
 

Pathways for UGP2 Antibody (H00007360-M01)

View related products by pathway.

Research Areas for UGP2 Antibody (H00007360-M01)

Find related products by research area.

Blogs on UGP2

There are no specific blogs for UGP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGP2 Antibody (3H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol UGP2
Entrez
OMIM
Uniprot