UGP2 Antibody (3H3) - Azide and BSA Free

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in NIH/3T3.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UGP2 monoclonal antibody (M01), clone 3H3 (Cat # H00007360-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3 Analysis of UGP2 expression in HeLa.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in PC-12.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in Raw 264.7.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.Lane 1: UGP2 transfected lysate(56.9 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: UGP2 Antibody (3H3) [H00007360-M01] - Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, KD
• Clone: 3H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UGP2 Antibody (3H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
• Localization: Cytoplasmic
• Specificity: UGP2 - UDP-glucose pyrophosphorylase 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UGP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGP2 Antibody (3H3) - Azide and BSA Free

• EC 2.7.7.9
• pHC379
• UDPG
• UDP-glucose diphosphorylase
• UDP-glucose pyrophosphorylase 2
• UDP-glucose pyrophosphorylase
• UDPGP
• UDPGP2
• UGP1
• UGPase 2
• UGPase
• UGPP2
• uridyl diphosphate glucose pyrophosphorylase 2
• UTP-glucose-1-phosphate uridyltransferase
• UTP--glucose-1-phosphate uridylyltransferase 2
• UTP--glucose-1-phosphate uridylyltransferase

Background

The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGP2
• Entrez:
  • 7360(Human)
• OMIM:
  • 191760(Human)
• Uniprot:
  • NP_001001521(Human)