Recombinant Human UEVLD Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UEVLD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-357 of Human UEV3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRDIMI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UEVLD

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UEVLD Protein

  • Attp
  • EV and lactate/malate dehydrogenase domain-containing protein
  • signaling molecule ATTP
  • ubiquitin-conjugating enzyme E2 variant 3
  • UEV and lactate/malate dehyrogenase domains
  • UEV-3
  • UEV3FLJ11068

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF4245
Species: Hu
Applications: WB, IP
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055293-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for UEVLD Recombinant Protein (H00055293-P01) (0)

There are no publications for UEVLD Recombinant Protein (H00055293-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UEVLD Recombinant Protein (H00055293-P01) (0)

There are no reviews for UEVLD Recombinant Protein (H00055293-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UEVLD Recombinant Protein (H00055293-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UEVLD Products

Bioinformatics Tool for UEVLD Recombinant Protein (H00055293-P01)

Discover related pathways, diseases and genes to UEVLD Recombinant Protein (H00055293-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UEVLD

There are no specific blogs for UEVLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
UEVLD Antibody
NBP1-92561
SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UEVLD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UEVLD