UBTF Antibody (6B6) - Azide and BSA Free

Western Blot: UBTF Antibody (6B6) [H00007343-M01] - UBTF monoclonal antibody (M01), clone 6B6 Analysis of UBTF expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: UBTF Antibody (6B6) [H00007343-M01] - Analysis of monoclonal antibody to UBTF on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: UBTF Antibody (6B6) [H00007343-M01] - Analysis of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Sandwich ELISA: UBTF Antibody (6B6) [H00007343-M01] - Detection limit for recombinant GST tagged UBTF is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Po, Bv, Pm
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

UBTF Antibody (6B6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
• Localization: Nuclear
• Specificity: UBTF - upstream binding transcription factor, RNA polymerase I
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBTF
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBTF Antibody (6B6) - Azide and BSA Free

• 90-KDa Nucleolus Organizer Region Autoantigen
• Autoantigen NOR-90
• NOR-90
• nucleolar transcription factor 1
• UBF
• UBF1
• UBF-1
• UBF2
• UBFUBF-1
• upstream binding transcription factor, RNA polymerase I
• Upstream-binding factor 1

Background

Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBTF Antibody (H00007343-M01)(10)

Publications using H00007343-M01

• Kitaoka M, Smith OK, Straight AF, Heald R Molecular conflicts disrupting centromere maintenance contribute to Xenopus hybrid inviability Current biology : CB 2022-08-06 [PMID: 35973429]
  
  Details:
  X. laevis and X. tropicalis; Dilutions: 1:500
• Martine Chebrout, Maïmouna Coura Koné, Habib U Jan, Marie Cournut, Martine Letheule, Renaud Fleurot, Tiphaine Aguirre-Lavin, Nathalie Peynot, Alice Jouneau, Nathalie Beaujean, Amélie Bonnet-Garnier Transcription of rRNA in early mouse embryos promotes chromatin reorganization and expression of major satellite repeats. Journal of cell science 2022-05-06 [PMID: 35048992]
• David D, Anna S, Cornelia D et al. Nucleolar Stress Functions Upstream to Stimulate Expression of Autophagy Regulators. Cancers (Basel). 2021-12-20 [PMID: 34944838]
• Kone MC, Fleurot R, Chebrout M et al. Three-Dimensional Distribution of UBF and Nopp140 in Relationship to Ribosomal DNA Transcription During Mouse Preimplantation Development. Biol Reprod 2016-04-01 [PMID: 26984997]
• Fulka H, Langerova A. The maternal nucleolus plays a key role in centromere satellite maintenance during the oocyte to embryo transition. Development. 2014-04-01 [PMID: 24715459]
• Kalt I, Levy A, Borodianskiy-Shteinberg T, Sarid R. Nucleolar localization of GLTSCR2/PICT-1 is mediated by multiple unique nucleolar localization sequences. PLoS One. 2012-01-01 [PMID: 22292050] (Human)
• Zougman A, Mann M, Wisniewski JR. et al. Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene. Nucleic Acids Res 2011-05-17 [PMID: 21586586] (WB)
• Ostrup O, Strejcek F, Petrovicova I et al. Role of Ooplasm in Nuclear and Nucleolar Remodeling of Intergeneric Somatic Cell Nuclear Transfer Embryos during the First Cell Cycle. Cell Reprogram. 2011-04-01 [PMID: 21473691]
• Song BS, Lee SH, Kim SU, et al. Nucleologenesis and embryonic genome activation are defective in interspecies cloned embryos between bovine ooplasm and rhesus monkey somatic cells. BMC Dev Biol;9:44. 2009-07-28 [PMID: 19635167]
• ostrup O, Petrovicova I, Strejcek F et al. Nuclear and nucleolar reprogramming during the first cell cycle in bovine nuclear transfer embryos. Cloning Stem Cells 11(3):367-75. 2009-09-01 [PMID: 19594386]

Bioinformatics

• Gene Symbol: UBTF
• Entrez:
  • 7343(Human)
• OMIM:
  • 600673(Human)
• Uniprot:
  • NP_055048(Human)