UBTF Antibody (2D8)

Images

 
Western Blot: UBTF Antibody (2D8) [H00007343-M04] - Analysis of UBTF expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: UBTF Antibody (2D8) [H00007343-M04] - Analysis of monoclonal antibody to UBTF on HepG2 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: UBTF Antibody (2D8) [H00007343-M04] - Analysis of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: UBTF Antibody (2D8) [H00007343-M04] - Analysis of UBTF expression in PC-12 (Cat # L012V1).
Western Blot: UBTF Antibody (2D8) [H00007343-M04] - Analysis of UBTF expression in NIH/3T3 (Cat # L018V1).
ELISA: UBTF Antibody (2D8) [H00007343-M04] - Detection limit for recombinant GST tagged UBTF is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBTF Antibody (2D8) Summary

Immunogen
UBTF (NP_055048 551 a.a. - 650 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Specificity
UBTF - upstream binding transcription factor, RNA polymerase I (2D8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBTF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBTF Antibody (2D8)

  • 90-KDa Nucleolus Organizer Region Autoantigen
  • Autoantigen NOR-90
  • NOR-90
  • nucleolar transcription factor 1
  • UBF
  • UBF1
  • UBF-1
  • UBF2
  • UBFUBF-1
  • upstream binding transcription factor, RNA polymerase I
  • Upstream-binding factor 1

Background

Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, exist in the human (Bell et al., 1988 [PubMed 3413483]). UBF is a nucleolar phosphoprotein with both DNA binding and transactivation domains. Sequence-specific DNA binding to the core and upstream control elements of the human rRNA promoter is mediated through several HMG boxes (Jantzen et al., 1990 [PubMed 2330041]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-12779
Species: Hu
Applications: WB, IP
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-89867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for UBTF Antibody (H00007343-M04) (0)

There are no publications for UBTF Antibody (H00007343-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBTF Antibody (H00007343-M04) (0)

There are no reviews for UBTF Antibody (H00007343-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBTF Antibody (H00007343-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBTF Products

Bioinformatics Tool for UBTF Antibody (H00007343-M04)

Discover related pathways, diseases and genes to UBTF Antibody (H00007343-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBTF Antibody (H00007343-M04)

Discover more about diseases related to UBTF Antibody (H00007343-M04).
 

Pathways for UBTF Antibody (H00007343-M04)

View related products by pathway.

PTMs for UBTF Antibody (H00007343-M04)

Learn more about PTMs related to UBTF Antibody (H00007343-M04).

Blogs on UBTF

There are no specific blogs for UBTF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBTF Antibody (2D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBTF
Entrez
OMIM
Uniprot