UBR4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

UBR4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBR4.
  
  

  Source: E. coli

  Amino Acid Sequence: VEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: UBR4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83003.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UBR4 Recombinant Protein Antigen

• 600 kDa retinoblastoma protein-associated factor
• EC 6.3.2
• EC 6.3.2.-
• KIAA0462E3 ubiquitin-protein ligase UBR4
• KIAA1307zinc finger, UBR1 type 1
• N-recognin-4
• p600
• RBAF600FLJ41863
• Retinoblastoma-associated factor of 600 kDa
• ubiquitin protein ligase E3 component n-recognin 4
• Zinc finger UBR1-type protein 1
• ZUBR1retinoblastoma-associated factor 600-like protein

Background

p600 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. It recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, p600 forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Additionally p600 regulates integrin-mediated signaling and may play a role in activation of FAK in response to cell-matrix interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: UBR4