Recombinant Human UBR4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UBR4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 94-190 of Human RBAF600 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UBR4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBR4 Protein

  • 600 kDa retinoblastoma protein-associated factor
  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0462E3 ubiquitin-protein ligase UBR4
  • KIAA1307zinc finger, UBR1 type 1
  • N-recognin-4
  • p600
  • RBAF600FLJ41863
  • Retinoblastoma-associated factor of 600 kDa
  • ubiquitin protein ligase E3 component n-recognin 4
  • Zinc finger UBR1-type protein 1
  • ZUBR1retinoblastoma-associated factor 600-like protein

Background

RBAF600 - retinoblastoma-associated factor 600

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16155
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for UBR4 Partial Recombinant Protein (H00023352-Q01) (0)

There are no publications for UBR4 Partial Recombinant Protein (H00023352-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR4 Partial Recombinant Protein (H00023352-Q01) (0)

There are no reviews for UBR4 Partial Recombinant Protein (H00023352-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBR4 Partial Recombinant Protein (H00023352-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBR4 Products

Bioinformatics Tool for UBR4 Partial Recombinant Protein (H00023352-Q01)

Discover related pathways, diseases and genes to UBR4 Partial Recombinant Protein (H00023352-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR4 Partial Recombinant Protein (H00023352-Q01)

Discover more about diseases related to UBR4 Partial Recombinant Protein (H00023352-Q01).
 

Pathways for UBR4 Partial Recombinant Protein (H00023352-Q01)

View related products by pathway.

PTMs for UBR4 Partial Recombinant Protein (H00023352-Q01)

Learn more about PTMs related to UBR4 Partial Recombinant Protein (H00023352-Q01).

Blogs on UBR4

There are no specific blogs for UBR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
UBR4 Antibody
NBP1-28730

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBR4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR4