UBL3 Recombinant Protein Antigen

Images

 
There are currently no images for UBL3 Protein (NBP2-31566PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UBL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBL3.

Source: E.coli

Amino Acid Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-31566.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for UBL3 Recombinant Protein Antigen

  • DKFZP434K151
  • FLJ32018
  • HCG-1
  • hsMUB
  • Membrane-anchored ubiquitin-fold protein
  • MUB
  • PNSC1
  • Protein HCG-1
  • ubiquitin-like 3
  • ubiquitin-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-03747
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, Flow-IC
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF8198
Species: Hu
Applications: ELISA, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-48748
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-84996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBL3 Protein (NBP2-31566PEP) (0)

There are no publications for UBL3 Protein (NBP2-31566PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBL3 Protein (NBP2-31566PEP) (0)

There are no reviews for UBL3 Protein (NBP2-31566PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for UBL3 Protein (NBP2-31566PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for UBL3 Protein (NBP2-31566PEP)

Discover related pathways, diseases and genes to UBL3 Protein (NBP2-31566PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBL3 Protein (NBP2-31566PEP)

Discover more about diseases related to UBL3 Protein (NBP2-31566PEP).

Blogs on UBL3

There are no specific blogs for UBL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UBL3 Antibody
NBP2-31566

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UBL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBL3