UBE2K/E2-25K Antibody - BSA Free

Western Blot: UBE2K/E2-25K Antibody [NBP1-54914] - Jurkat cell lysate, concentration 5.0ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

UBE2K/E2-25K Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to UBE2K/E2-25K The peptide sequence was selected from the N terminal of UBE2K/E2-25K. Peptide sequence MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBE2K
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for UBE2K/E2-25K Antibody - BSA Free

• E2(25K)
• E225K
• E2-25K
• EC 6.3.2.19
• Hip2
• HIP-2
• huntingtin interacting protein 2
• Huntingtin-interacting protein 2
• HYPG
• LIG
• UbcH1
• UBE2K
• UBE2K-25K
• ubiquitin carrier protein
• ubiquitin-conjugating enzyme E2 K
• Ubiquitin-conjugating enzyme E2(25K)
• Ubiquitin-conjugating enzyme E2-25 kDa
• Ubiquitin-conjugating enzyme E2-25K
• ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast)
• ubiquitin-protein ligase

Background

HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBE2K
• Uniprot:
  • P61086(Human)