UBE2G1 Antibody (2A9-1F11)

Images

 
Immunocytochemistry/ Immunofluorescence: UBE2G1 Antibody (2A9-1F11) [H00007326-M02] - Analysis of monoclonal antibody to UBE2G1 on HeLa cell . Antibody concentration 20 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A9-1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBE2G1 Antibody (2A9-1F11) Summary

Immunogen
UBE2G1 (AAH02775, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Specificity
UBE2G1 - ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast) (2A9-1F11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2G1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2G1 Antibody (2A9-1F11)

  • E217K
  • EC 6.3.2.19
  • UBC7
  • UBE2G1
  • UBE2GE217K
  • Ubiquitin carrier protein G1
  • ubiquitin-conjugating enzyme E2 G1
  • ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans)
  • ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast)
  • Ubiquitin-protein ligase G1

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-74747
Species: Ca, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
E2-640
Species: Hu
Applications: EnzAct
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-15374
Species: Hu
Applications: Func, IHC, IHC-P, In vitro, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46278
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
NB100-2526
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
E2-622
Species: Hu
Applications: EnzAct
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-06088
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47510
Species: Hu
Applications: IHC, IHC-P, WB
U-100H
Species: Hu
Applications: EnzAct
NBP2-94633
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
E2-616
Species: Hu
Applications: EnzAct

Publications for UBE2G1 Antibody (H00007326-M02) (0)

There are no publications for UBE2G1 Antibody (H00007326-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2G1 Antibody (H00007326-M02) (0)

There are no reviews for UBE2G1 Antibody (H00007326-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2G1 Antibody (H00007326-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2G1 Products

Bioinformatics Tool for UBE2G1 Antibody (H00007326-M02)

Discover related pathways, diseases and genes to UBE2G1 Antibody (H00007326-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2G1 Antibody (H00007326-M02)

Discover more about diseases related to UBE2G1 Antibody (H00007326-M02).
 

Pathways for UBE2G1 Antibody (H00007326-M02)

View related products by pathway.

Research Areas for UBE2G1 Antibody (H00007326-M02)

Find related products by research area.

Blogs on UBE2G1

There are no specific blogs for UBE2G1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2G1 Antibody (2A9-1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2G1
Entrez
Uniprot